DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and SF2

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster


Alignment Length:275 Identity:81/275 - (29%)
Similarity:100/275 - (36%) Gaps:107/275 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI--AFNPPGFAFVEFEHRDDAEKACDIL 66
            ||.:...|:|||||...::..|::..|.|:||:..|.:  ...|| |||||||...||:.|....
  Fly     1 MGSRNECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPP-FAFVEFEDARDADDAVKAR 64

  Fly    67 NGSELLGSQLRVEISKGRPRQGRRGGPMD-RGGRRGDFGRHSITSGGSGGGGFRQRG-------- 122
            :|.:..|.:||||..:|       |||.. |||.|.|..|       .|||....||        
  Fly    65 DGYDYDGYRLRVEFPRG-------GGPGSYRGGNRNDRSR-------DGGGRMGGRGPPAKRSQY 115

  Fly   123 --------SSGSSS----------------------------RHTERGYS--------------- 136
                    :|||..                            ||.:..|:               
  Fly   116 RVMVTGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGE 180

  Fly   137 ---------SG---RSGASSYNGREGGGSGFNRREVYGGG----RDSSRYSSGSS-------ASY 178
                     ||   |.|....:|..|||||       |||    ||.||..|.||       .:|
  Fly   181 VAYIRVREDSGDNDRGGGGGGSGGGGGGSG-------GGGSRDYRDRSRSRSFSSRPRRRGTPTY 238

  Fly   179 GRTGGQSAGRFRSRS 193
            .....||..|.||||
  Fly   239 SPVRRQSYSRSRSRS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 30/72 (42%)
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 30/77 (39%)
RRM2_SRSF1_like 115..188 CDD:410013 6/72 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.