DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf10

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001011096.1 Gene:srsf10 / 496509 XenbaseID:XB-GENE-492982 Length:258 Species:Xenopus tropicalis


Alignment Length:257 Identity:64/257 - (24%)
Similarity:100/257 - (38%) Gaps:90/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGS 69
            |.::|.|:.|.::.:||..||.:||.:..|::..:     |.|||:|:||...|||.|...|:..
 Frog    10 TSLFVRNIADDIRSEDLRREFGRYGPIVDVYVPLDYYTRRPRGFAYVQFEDVRDAEDALHNLDKK 74

  Fly    70 ELLGSQLRVEISKG---RPRQ-------------------------------------------G 88
            .:.|.|:.::.::|   .|.|                                           |
 Frog    75 WICGRQIEIQFAQGDRKTPNQMKAKEGRSTYGSSRYDDDRHNRRSRSRSYERRRSRSRSFEQNYG 139

  Fly    89 RRGGPMDRGGRR----------GDFGRHSITSGGSGGGGFRQRGSSGSSSR-----HTERGYSSG 138
            |...|..|||.|          |.|.||:           |.|..|||:||     ..::.....
 Frog   140 RSYSPRGRGGERLHRSRSRSDHGRFNRHN-----------RSRSRSGSNSRSRSKSEPKKTVREQ 193

  Fly   139 RSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGS-------SASYGRTGGQSAGRFRSRS 193
            |||:.|::      .|.::.:.....|::|||:..|       |.|..|:..:|..:.||||
 Frog   194 RSGSRSHS------RGHSKADSKSRCRENSRYNRESRRDEHEQSKSPSRSVSRSRSKSRSRS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 24/75 (32%)
srsf10NP_001011096.1 RRM_SF 10..93 CDD:388407 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.