DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf3

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_012815513.1 Gene:srsf3 / 448605 XenbaseID:XB-GENE-490817 Length:183 Species:Xenopus tropicalis


Alignment Length:185 Identity:72/185 - (38%)
Similarity:88/185 - (47%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :||||||.:...|.:||..|..||.|.|||:|.|||||||||||...||..|...|:|..|.|.:
 Frog    30 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 94

  Fly    76 LRVEISKGRPRQGRRGGPMDRGGR-RGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGR 139
            :|||:|.|..|...||.|.....| |.|:.|.|...        |:|     |.|  .|.:|..|
 Frog    95 VRVELSNGEKRSRNRGPPPSWNRRPRDDYRRRSPPP--------RRR-----SPR--RRSFSRSR 144

  Fly   140 SGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGS-SASYGRTGGQSAGRFRSRS 193
            |.:.|.:         .|||     |..||..:.. |.|:.|:      |.||||
 Frog   145 SRSLSRD---------RRRE-----RSLSRERNHKPSRSFSRS------RSRSRS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 38/70 (54%)
srsf3XP_012815513.1 RRM <11..>112 CDD:223796 43/81 (53%)
RRM_SF 25..105 CDD:302621 40/74 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.