DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and rbm34

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001004890.1 Gene:rbm34 / 448232 XenbaseID:XB-GENE-5895036 Length:412 Species:Xenopus tropicalis


Alignment Length:85 Identity:27/85 - (31%)
Similarity:46/85 - (54%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEK 61
            ||..::|.  .::|||..:::::.:...|::.||:..|.|..:.     .||.:|.||..|..:.
 Frog   265 SSHDNKRS--AFIGNLPYEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGFGYVLFESADAVQL 327

  Fly    62 ACDILNGSELLGSQLRVEIS 81
            |.. ||.|||.|.::||:.|
 Frog   328 ALK-LNNSELSGRKIRVKRS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 24/76 (32%)
rbm34NP_001004890.1 RRM1_RBM34 168..259 CDD:409828
RRM2_RBM34 272..344 CDD:409829 22/74 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.