DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and mod

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:70 Identity:24/70 - (34%)
Similarity:33/70 - (47%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN---PPGFAFVEFEHRDDAEKACDILNGSELLG 73
            |.||.:...:.||||:..|.|...:.:|.|:.|   |.  |||.....||..||.. |:.:||..
  Fly   260 VVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPR--AFVRLASVDDIPKALK-LHSTELFS 321

  Fly    74 SQLRV 78
            ..:.|
  Fly   322 RFITV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 24/70 (34%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668 24/70 (34%)
RRM_SF 342..411 CDD:240668
RRM_SF 422..>465 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.