DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf2a

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_998547.1 Gene:srsf2a / 406691 ZFINID:ZDB-GENE-040426-2706 Length:225 Species:Danio rerio


Alignment Length:194 Identity:62/194 - (31%)
Similarity:85/194 - (43%) Gaps:46/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAEKACDILNGS 69
            |.:.|.|||.:...:.|...|.|||::..|:|     .....|||||.|..:.|||.|.|.::|:
Zfish    14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGA 78

  Fly    70 ELLGSQLRVEISK-GRP---RQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRH 130
            .|.|.:|||:::: |||   ...|||.|..|                .||.|.|.|..|....:|
Zfish    79 LLDGRELRVQMARYGRPPDAHYSRRGAPPRR----------------YGGYGRRSRSRSPRRRKH 127

  Fly   131 TERGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSP 194
            : |..|..||.:.|                    |..||||...|.||.|:..:|..|.::|:|
Zfish   128 S-RSRSRSRSRSRS--------------------RSRSRYSRSRSRSYSRSRSRSRSRSKTRTP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 28/75 (37%)
srsf2aNP_998547.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 27/71 (38%)

Return to query results.
Submit another query.