DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf7a

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:217 Identity:80/217 - (36%)
Similarity:106/217 - (48%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSMGDQRGT--RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACD 64
            ||....|.:  :||||:|.:...|.:||..|:.||.|.|||:|.|||||||||:|...|||.|..
Zfish     4 SSRSSSRTSDCKVYVGDLGNGAAKGELERAFSYYGPLRSVWVARNPPGFAFVEYEDARDAEDAVK 68

  Fly    65 ILNGSELLGSQLRVEISKGRPRQGRRG-------GPMDRGGRRGDFGRHSITSGGSGGGGFR--- 119
            .::|..|.|:::|||:|.|..|:.|.|       .|.||..:.|:.|.::...       :|   
Zfish    69 GMDGKVLCGARVRVELSNGMSRKSRYGRPSRRQFDPNDRCYQCGETGHYAYDC-------YRFSK 126

  Fly   120 ---QRGSSGSSSRHTERG--YSSGRSGASSYNGREGGGSGFNRREVYGG--GRDSSRYSSGSSAS 177
               :|..|||.||...||  |.|    .|..|.|......:::|....|  ||..||...|.|.|
Zfish   127 RRSRRSRSGSRSRSRSRGRRYRS----RSRSNERRYRSPSYSKRRSRSGSPGRSRSRSPGGRSRS 187

  Fly   178 YGRTGGQSAGRFRSRSPVGNHR 199
            ..|.......|.|||:|:  ||
Zfish   188 PVRRSKSPVRRSRSRTPL--HR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 36/70 (51%)
srsf7aNP_991236.1 RRM_SRSF3_like 15..87 CDD:240819 37/71 (52%)
zf-CCHC 108..121 CDD:278525 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.