DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and rbm4b

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b / 394812 XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis


Alignment Length:76 Identity:23/76 - (30%)
Similarity:42/76 - (55%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :::||||..:..:.:|:..|.::|::....|..|   :.||..|.|..|::|...||..:|....
 Frog     3 KLFVGNLPPEATQSELKSLFEQFGRVTECDIIKN---YGFVHMEDRKAADEAVHNLNHYKLHSVP 64

  Fly    76 LRVEISKGRPR 86
            :.||.|:|:|:
 Frog    65 INVEHSRGKPK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 20/70 (29%)
rbm4bNP_989204.1 RRM_SF 2..68 CDD:473069 18/67 (27%)
RRM_SF 78..144 CDD:473069
ZnF_C2HC 161..176 CDD:197667
COG5222 <162..>201 CDD:227547
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.