DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf10b

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_956827.1 Gene:srsf10b / 393505 ZFINID:ZDB-GENE-040426-1415 Length:248 Species:Danio rerio


Alignment Length:194 Identity:58/194 - (29%)
Similarity:89/194 - (45%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSEL 71
            ::|.|::|:.:.:||..||.:||.:..|:|..:     |.|||:::||...|||.|...|:...:
Zfish    12 LFVRNISDESRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYIQFEDVRDAEDALHNLDRKWV 76

  Fly    72 LGSQLRVEISKG-RPRQGR-----RGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRH 130
            .|.|:.::.::| |...|:     |..|  |..|..|..|             |:|..|.|..|.
Zfish    77 CGRQIEIQFAQGDRKTPGQMKNKERSSP--RSSRYEDSDR-------------RRRSRSRSYDRR 126

  Fly   131 TERGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSP 194
            ..|..|..|....|.:.||..|...:||     .|:..|: .||:..:.|:...:|.  |||||
Zfish   127 RSRSPSYDRRRRRSDSPRESRGRTHSRR-----SREHDRH-RGSTRDHHRSRTDAAS--RSRSP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 24/74 (32%)
srsf10bNP_956827.1 RRM <6..>92 CDD:223796 26/79 (33%)
RRM_SRSF10 10..93 CDD:241003 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.