DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and lark

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:170 Identity:52/170 - (30%)
Similarity:76/170 - (44%) Gaps:25/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGS 74
            |:::|||||||.:..::...|.|||.:....|..|   :.||..:...|.:.|...|||..:.|.
  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQ 147

  Fly    75 QLRVEI--SKGRPRQGRRGGPMD--RGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGY 135
            .|:|::  |:.||:.| .|.|..  |.||.|.:.:......||.||| |:..|..|:..:.:|.|
  Fly   148 PLKVQVSTSRVRPKPG-MGDPEQCYRCGRSGHWSKECPRLYGSAGGG-REPPSPLSAGGYRDRMY 210

  Fly   136 SSGRSGASSYNGRE-----GGGSGFNRREVYGGGRDSSRY 170
                       ||:     .....|.|..:..|.||...|
  Fly   211 -----------GRDPYPPPPPPPPFLRDRIMDGFRDYDYY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 23/72 (32%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 22/67 (33%)
hnRNP-R-Q <88..>258 CDD:273732 51/168 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.