DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf3a

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001002053.1 Gene:srsf3a / 368925 ZFINID:ZDB-GENE-030616-631 Length:174 Species:Danio rerio


Alignment Length:196 Identity:78/196 - (39%)
Similarity:93/196 - (47%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MGDQRGTR-------VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEK 61
            |||...||       ||||||.:...|.:||..|..||.|.|||:|.|||||||||||...||..
Zfish     1 MGDPSLTRDCPLDCKVYVGNLGNSGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDATD 65

  Fly    62 ACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGR-RGDFGRHSITSGGSGGGGFRQRGSSG 125
            |...|:|..|.|.::|||:|.|..|...||.|.....| |.|:.|         |..:|:|.|..
Zfish    66 AVRELDGRTLCGCRVRVEMSNGEKRSRFRGPPPSWSRRPRDDYRR---------GDDYRRRSSPP 121

  Fly   126 SSSRHTERGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSR---YSSGSSASYGRTGGQSAG 187
            :..|...|.:|..||.:.|   ||      .|||     |..||   |....|.|..|:..:|.|
Zfish   122 ARHRSPRRSFSRSRSRSLS---RE------RRRE-----RSLSRDRNYKPSRSFSGSRSRSRSNG 172

  Fly   188 R 188
            |
Zfish   173 R 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 39/77 (51%)
srsf3aNP_001002053.1 RRM_SF 10..90 CDD:302621 40/79 (51%)
RRM <13..>97 CDD:223796 43/83 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.