DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Srsf7

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001034124.2 Gene:Srsf7 / 362687 RGDID:1307425 Length:238 Species:Rattus norvegicus


Alignment Length:238 Identity:86/238 - (36%)
Similarity:102/238 - (42%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRG-TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACD 64
            ||..|...| |:||||||.....|.:||..|:.||.|.:||||.|||||||||||...|||.|..
  Rat     1 MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVR 65

  Fly    65 ILNGSELLGSQLRVEISKGRPRQGRRGGPMDRG-----------GRRG----DFGRHSITSGGSG 114
            .|:|..:.||::|||:|.|.||:.|...|..|.           |.:|    |..|:|...    
  Rat    66 GLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRR---- 126

  Fly   115 GGGFRQRGSSGSSSRHTERGYSSGRSGASSYNGREG----------------------GGSGFNR 157
                |.|..|.|.||...|.||..||.:.....|..                      .||....
  Rat   127 ----RSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGS 187

  Fly   158 REVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGN-HR 199
            |......|..||..|.|.....|:..:|....|||||.|: ||
  Rat   188 RYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 39/70 (56%)
Srsf7NP_001034124.2 RRM_SRSF7 12..88 CDD:410050 42/75 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.