DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Srsf10

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_006239282.1 Gene:Srsf10 / 362630 RGDID:1311067 Length:262 Species:Rattus norvegicus


Alignment Length:244 Identity:58/244 - (23%)
Similarity:94/244 - (38%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGS 69
            |.::|.|:.|..:.:||..||.:||.:..|::..:     |.|||:|:||...|||.|...|:..
  Rat    10 TSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRK 74

  Fly    70 ELLGSQLRVEISKG--------RPRQGR---------------------------RGGPMDRGGR 99
            .:.|.|:.::.::|        :.::||                           |....|...|
  Rat    75 WICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYR 139

  Fly   100 RGDFGRHSITSG-------GSGGGGFRQRGSSGSSSRHTERGYS----------SGRSGASSYNG 147
            |....|:|..:|       .|....|:.|..|.|.|:...|..|          ..||.::|:..
  Rat   140 RSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTK 204

  Fly   148 REGGGSGFNRREVYGGGR---DSSRYSSGSSASYGRTGGQSAGRFRSRS 193
            ..|.....::.....|.|   :|.:.....|.|..|:..:|..:.||||
  Rat   205 TRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 24/75 (32%)
Srsf10XP_006239282.1 RRM_SF 5..99 CDD:473069 26/88 (30%)

Return to query results.
Submit another query.