DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Srsf3

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001041372.1 Gene:Srsf3 / 361814 RGDID:1309233 Length:164 Species:Rattus norvegicus


Alignment Length:185 Identity:73/185 - (39%)
Similarity:89/185 - (48%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :||||||.:...|.:||..|..||.|.|||:|.|||||||||||...||..|...|:|..|.|.:
  Rat    11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75

  Fly    76 LRVEISKGRPRQGRRGGPMDRGGR-RGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGR 139
            :|||:|.|..|...||.|...|.| |.|:.|.|...        |:|     |.|  .|.:|..|
  Rat    76 VRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPP--------RRR-----SPR--RRSFSRSR 125

  Fly   140 SGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGS-SASYGRTGGQSAGRFRSRS 193
            |.:.|.:         .|||     |..||..:.. |.|:.|:      |.||||
  Rat   126 SRSLSRD---------RRRE-----RSLSRERNHKPSRSFSRS------RSRSRS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 38/70 (54%)
Srsf3NP_001041372.1 RRM_SRSF3 6..86 CDD:241089 40/74 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.