DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Pabp2

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:124 Identity:40/124 - (32%)
Similarity:55/124 - (44%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSEL 71
            |||||:......::||..|...|.:|.|.|..|     |.|||::||..::..|.|. .:|.:..
  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETLF 161

  Fly    72 LGSQLRVEISKGRPRQG-------RRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGS 123
            .|.|::| :||...|.|       .||....||.|......||...|.....|:|.|.:
  Fly   162 RGRQIKV-MSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRAN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 25/74 (34%)
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.