DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and SPAC25G10.01

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001342863.1 Gene:SPAC25G10.01 / 3361412 PomBaseID:SPAC25G10.01 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:53/197 - (26%)
Similarity:78/197 - (39%) Gaps:59/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNG 68
            |..::|..:..::::|:|:..|:|:|.:..|.|...|     .||.|:.|...::|..|.|.||.
pombe   100 GNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVEEATSAIDNLNS 164

  Fly    69 SELLGSQLRVEISK-GRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTE 132
            .|..|..|.|:.:| .||                    ||.|.|          ...|...|...
pombe   165 QEFYGRVLNVQKAKRSRP--------------------HSPTPG----------KYMGYDRRRNS 199

  Fly   133 RGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGN 197
            |.:.|        |.::||....|.|:     |||:||.:    ||..:..|     |..|| ||
pombe   200 RDFPS--------NNKDGGYRRNNYRD-----RDSNRYRN----SYRPSRPQ-----REHSP-GN 241

  Fly   198 HR 199
            :|
pombe   242 YR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 22/75 (29%)
SPAC25G10.01NP_001342863.1 RRM 9..>225 CDD:223796 43/167 (26%)
RRM_RBMX_like 100..179 CDD:240828 23/78 (29%)
RRM 207..>283 CDD:330708 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.