DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Rbp1-like

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:171 Identity:74/171 - (43%)
Similarity:90/171 - (52%) Gaps:38/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :||||||.....|.::|..|:|||.|.:||:|.|||||||||||.|.|||.|...|:|:...|::
  Fly    12 KVYVGNLGSSASKYEIENAFSKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRGLDGTRCCGTR 76

  Fly    76 LRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGRS 140
            :|||:|.||.|:||.||                  ||.||||    |.||...|       .|.|
  Fly    77 IRVEMSSGRSREGRGGG------------------GGGGGGG----GGSGGGGR-------GGGS 112

  Fly   141 GASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRT 181
            ||     |.|||.    |...||||...:.||.::.|..||
  Fly   113 GA-----RAGGGG----RAGDGGGRYRIKSSSSTTTSTTRT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 38/70 (54%)
Rbp1-likeNP_001188585.1 RRM <11..>81 CDD:223796 37/68 (54%)
RRM_SRSF3_like 12..81 CDD:240819 37/68 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I3142
eggNOG 1 0.900 - - E1_KOG0107
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5201
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm954
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.