DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and TRA2A

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:179 Identity:58/179 - (32%)
Similarity:79/179 - (44%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSELLGSQLRVEISKGR 84
            ||...|::||.|:.|.:.::     ..|||||.||..||:::|.:..||.||.|.::||:.|..:
Human   134 DLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITK 198

  Fly    85 ----PRQG-RRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGRSGASS 144
                |..| ..|.|...||..|..|      ||.||||.|:|.|      :.:|||.        
Human   199 RAHTPTPGIYMGRPTHSGGGGGGGG------GGGGGGGGRRRDS------YYDRGYD-------- 243

  Fly   145 YNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRS 193
                    .|::|.|.|     ..||...|.:.|       ..|:||||
Human   244 --------RGYDRYEDY-----DYRYRRRSPSPY-------YSRYRSRS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 24/61 (39%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
RRM_TRA2 118..197 CDD:409798 25/62 (40%)
Linker 198..225 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 20/71 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.