DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and ctf1

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_596669.1 Gene:ctf1 / 2541018 PomBaseID:SPBC3B9.11c Length:363 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:45/202 - (22%)
Similarity:74/202 - (36%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNG 68
            |..|:|||:...|.:..:...|.:.|.:.:..:..:|     .|:.|.||...:....|...||.
pombe     6 GNVVFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRKLNN 70

  Fly    69 SELLGSQLRVEISKGRPRQGRRGGPMDRGGR--------RGDFGR-------HSITSGGSGGGGF 118
            |||...::|||.....||:.:.....:|..|        ...:..       ||.:|..:..||.
pombe    71 SELGPRKIRVEFPSNDPRRNQSYEYTERTDRYMEQQNAHESSYNSRFIPPVLHSTSSLPASQGGG 135

  Fly   119 RQRGSSGSSSRHTERGYSSGRSGASSYNGREGGGSGFN-----RREVYG--------GGRDSSRY 170
            ....:..|||..|....:...:...:||......|.|:     ..:.|.        ..::...|
pombe   136 MPSPAIYSSSMATNLNKNINSTSVPAYNFHNSMTSDFDSASQPHTDAYNARTFQYNKSSQNKGDY 200

  Fly   171 SSGSSAS 177
            :||:|.|
pombe   201 TSGTSIS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 21/75 (28%)
ctf1NP_596669.1 RRM_CSTF2_RNA15_like 9..83 CDD:240844 21/73 (29%)
CSTF2_hinge 208..281 CDD:291025 45/202 (22%)
CSTF_C 329..359 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.