DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and RBM34

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:109 Identity:35/109 - (32%)
Similarity:52/109 - (47%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEK 61
            :|..|:|.  |:||||..||::..:|..|...|.:.:|.|..:.     .||.:|.||:.|....
Human   281 TSSRDKRS--VFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHL 343

  Fly    62 ACDILNGSELLGSQLRV--EISK---------------GRPRQG 88
            |.. ||.|||:|.:|||  .::|               .:|:||
Human   344 ALK-LNNSELMGRKLRVMRSVNKEKFKQQNSNPRLKNVSKPKQG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 28/77 (36%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM1_RBM34 185..276 CDD:409828
RRM2_RBM34 288..360 CDD:409829 27/74 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.