DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Srsf7

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_666195.1 Gene:Srsf7 / 225027 MGIID:1926232 Length:238 Species:Mus musculus


Alignment Length:238 Identity:86/238 - (36%)
Similarity:102/238 - (42%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRG-TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACD 64
            ||..|...| |:||||||.....|.:||..|:.||.|.:||||.|||||||||||...|||.|..
Mouse     1 MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVR 65

  Fly    65 ILNGSELLGSQLRVEISKGRPRQGRRGGPMDRG-----------GRRG----DFGRHSITSGGSG 114
            .|:|..:.||::|||:|.|.||:.|...|..|.           |.:|    |..|:|...    
Mouse    66 GLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRR---- 126

  Fly   115 GGGFRQRGSSGSSSRHTERGYSSGRSGASSYNGREG----------------------GGSGFNR 157
                |.|..|.|.||...|.||..||.:.....|..                      .||....
Mouse   127 ----RSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGS 187

  Fly   158 REVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGN-HR 199
            |......|..||..|.|.....|:..:|....|||||.|: ||
Mouse   188 RYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 39/70 (56%)
Srsf7NP_666195.1 RRM_SRSF7 12..88 CDD:410050 42/75 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.