DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Srsf2

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_035488.1 Gene:Srsf2 / 20382 MGIID:98284 Length:221 Species:Mus musculus


Alignment Length:195 Identity:69/195 - (35%)
Similarity:91/195 - (46%) Gaps:26/195 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAEKACDILNGS 69
            |.:.|.|||.:...|.|...|.|||::..|:|     .....|||||.|..:.|||.|.|.::|:
Mouse    14 TSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGA 78

  Fly    70 ELLGSQLRVEISK-GRP---RQGRRGGPMDR-GGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSR 129
            .|.|.:|||:::: |||   ...|||.|..| ||  |.:||.|.:.        |:|..|.|.||
Mouse    79 VLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGG--GGYGRRSRSP--------RRRRRSRSRSR 133

  Fly   130 HTERGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSP 194
            ...|..|..|...|....|....|....:.      .|:|.|...|:|..|:..:|..|.|||||
Mouse   134 SRSRSRSRSRYSRSKSRSRTRSRSRSTSKS------RSARRSKSKSSSVSRSRSRSRSRSRSRSP 192

  Fly   195  194
            Mouse   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 29/75 (39%)
Srsf2NP_035488.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 28/71 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 39/117 (33%)

Return to query results.
Submit another query.