DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Rbm3

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001159881.1 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:205 Identity:62/205 - (30%)
Similarity:85/205 - (41%) Gaps:65/205 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEF---EHRDDAE 60
            |..:.| :::||.|.....:..||..|:.:|.::.|.:..:     ..||.|:.|   ||..||.
Mouse     1 MSSEEG-KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAM 64

  Fly    61 KACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSG 125
            :|   :||..|.|.|:||: ..|:..:|.|||..  |||...:.|         |||        
Mouse    65 RA---MNGESLDGRQIRVD-HAGKSARGSRGGAF--GGRGRSYSR---------GGG-------- 106

  Fly   126 SSSRHTERGYSSGRSGASSYNGREGG-GSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRF 189
                  ::||.|||     |:.|.|| |.|      ||..||   ||..|...|.|..|      
Mouse   107 ------DQGYGSGR-----YDSRPGGYGYG------YGRSRD---YSGRSQGGYDRYSG------ 145

  Fly   190 RSRSPVGNHR 199
                  ||:|
Mouse   146 ------GNYR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 24/78 (31%)
Rbm3NP_001159881.1 RRM_CIRBP_RBM3 6..85 CDD:240895 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.