powered by:
Protein Alignment Rsf1 and Y57G11A.5
DIOPT Version :9
Sequence 1: | NP_001260318.1 |
Gene: | Rsf1 / 34370 |
FlyBaseID: | FBgn0011305 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502757.2 |
Gene: | Y57G11A.5 / 190364 |
WormBaseID: | WBGene00013293 |
Length: | 110 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 41/70 - (58%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
:|||||:.....:.::|..|:..|.:.|:|:|..|||||||.|:....|..|...|||.::...:
Worm 18 QVYVGNMPFDATEKEIEAVFSVMGPIKSIWMAKRPPGFAFVTFKRTVHAFDAVKYLNGKKICDLE 82
Fly 76 LRVEI 80
.:||:
Worm 83 AKVEM 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0107 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1533297at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000474 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.