DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and Y57G11A.5

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_502757.2 Gene:Y57G11A.5 / 190364 WormBaseID:WBGene00013293 Length:110 Species:Caenorhabditis elegans


Alignment Length:70 Identity:26/70 - (37%)
Similarity:41/70 - (58%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :|||||:.....:.::|..|:..|.:.|:|:|..|||||||.|:....|..|...|||.::...:
 Worm    18 QVYVGNMPFDATEKEIEAVFSVMGPIKSIWMAKRPPGFAFVTFKRTVHAFDAVKYLNGKKICDLE 82

  Fly    76 LRVEI 80
            .:||:
 Worm    83 AKVEM 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 26/70 (37%)
Y57G11A.5NP_502757.2 RRM_SF 19..87 CDD:388407 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.