DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and rnp-9

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:110 Identity:27/110 - (24%)
Similarity:41/110 - (37%) Gaps:31/110 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 WIKVKPSQ-ASSFIVMAGASLHVLLNGGVFPPLHRVVITGKKDRYVAALFT-IPKEGVIINAPEE 282
            ||....|: |:..:|:....|..|  ||||        |..:|.|:.::.| :|.          
 Worm   303 WIAENASEMAAGDMVIRSVLLACL--GGVF--------TMSRDTYLTSVRTFLPS---------- 347

  Fly   283 MVDDEHPRLYK----PFDFWGFLKFSNLP----NARKDISDLTDY 319
             |.|.....:|    |:....:|.|...|    .|...:..|:||
 Worm   348 -VKDTFILSFKLGVLPWLLGCWLHFCTFPILGKTASHTVEVLSDY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:409789
RRM_SF 189..259 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.