DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and rnp-4

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001369846.1 Gene:rnp-4 / 175572 WormBaseID:WBGene00004387 Length:142 Species:Caenorhabditis elegans


Alignment Length:89 Identity:27/89 - (30%)
Similarity:53/89 - (59%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNG 68
            |..|:|.|:.::..:||:..:|::|||:.::.:..:.     .|:|.||:|.:.:|.:|.|..|.
 Worm    54 GWIVFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAIDQSND 118

  Fly    69 SELLGSQLRVE--ISKGRPRQGRR 90
            ::|||..::|:  ..||:...|:|
 Worm   119 TDLLGQNVKVDWCFVKGKKTSGKR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 22/77 (29%)
rnp-4NP_001369846.1 RRM_RBM8 49..136 CDD:409762 24/81 (30%)

Return to query results.
Submit another query.