DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and SRSF12

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_542781.3 Gene:SRSF12 / 135295 HGNCID:21220 Length:261 Species:Homo sapiens


Alignment Length:222 Identity:60/222 - (27%)
Similarity:91/222 - (40%) Gaps:36/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGS 69
            |.:::.|:.|..:.:||..||.:||.:..|:|..:     |.|||:|:||...|||.|...||..
Human    10 TSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYNLNRK 74

  Fly    70 ELLGSQLRVEISKG--------RPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGS 126
            .:.|.|:.::.::|        :.::.....|.|....|....|.: .|..|..|..|:|..|..
Human    75 WVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRT-RSRSSSWGRNRRRSDSLK 138

  Fly   127 SSRHTERGYSSGRSGASSY-------------------NGREGGGSGFNRREVYGGGRDSSRYSS 172
            .|||....||..:|.:.|.                   .||....|...|.:..|..:.||....
Human   139 ESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQ 203

  Fly   173 GSSASYGRTGGQ---SAGRFRSRSPVG 196
            .||.:..|:.|:   |..|...:||.|
Human   204 TSSGTKSRSHGRHSDSIARSPCKSPKG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 25/75 (33%)
SRSF12NP_542781.3 RRM_SRSF10_SRSF12 10..93 CDD:240758 27/82 (33%)
PABP-1234 <12..211 CDD:130689 52/199 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..261 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.