DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf3b

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_021324965.1 Gene:srsf3b / 100145909 ZFINID:ZDB-GENE-071005-2 Length:358 Species:Danio rerio


Alignment Length:116 Identity:30/116 - (25%)
Similarity:43/116 - (37%) Gaps:36/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FGRHSITSGGS---GGGGFRQRGSSGSSSRHTERGYSSGRSG---AS------------SYNGRE 149
            |||..:.:..|   .|.|...|.|...|:|.||:..|..||.   ||            ::..:|
Zfish    21 FGRGRLFANSSTPVAGRGSVGRTSEFCSTRVTEQTPSQLRSNPFLASPDLNDTAWQNLITHIAQE 85

  Fly   150 GGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSPVGNHRF 200
            .|.:..:   |.|||    ||..|.:           ...:::|||....|
Zfish    86 VGQTLIS---VQGGG----RYGEGET-----------NNAQTQSPVAGQSF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808
srsf3bXP_021324965.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.