DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and FUN14

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_009394.1 Gene:FUN14 / 851225 SGDID:S000000006 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:25/78 - (32%)
Similarity:36/78 - (46%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAHQEGLIKINWSKLDKSVDKLAD-- 81
            |::.||.:|...|.|.|.|..||.....:....|::|.|....:|.|:||...: |||..|.|  
Yeast   101 SSHKQMFLGSLFGVVLGVTVAKISILFMYVGITSMLLCEWLRYKGWIRINLKNI-KSVIVLKDVD 164

  Fly    82 ----KVEASLGRE 90
                .::..||.|
Yeast   165 LKKLLIDGLLGTE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 23/73 (32%)
FUN14NP_009394.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.