DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and fundc2

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001005954.1 Gene:fundc2 / 792181 ZFINID:ZDB-GENE-041010-26 Length:147 Species:Danio rerio


Alignment Length:156 Identity:48/156 - (30%)
Similarity:73/156 - (46%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YSEIFKKVFNDIG----QRSAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAHQEGL 64
            ::::|.|  |..|    :.|..:|:.||..|||..||...|:||.||.||||...||:|||..|.
Zfish    24 WNKMFGK--NSSGPAAEKYSVATQLAIGRVSGWCAGYLFQKVGKVAASAVGGGFFLLQIAHHTGY 86

  Fly    65 IKINWSKLDKSVDKLADKVEASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKWYTKLIGD 129
            |||:|.:::..|:|.  |.:..|..:|..|:.|.::.:.||....:::...|             
Zfish    87 IKIDWKRVEHDVNKA--KKQLKLNSDKPPKEVTTKFNEVQLFVKNNIVLTGG------------- 136

  Fly   130 EEGPKVNDLHIFLASFFGGVALGIAT 155
                           |.||..||:|:
Zfish   137 ---------------FAGGFLLGLAS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 40/128 (31%)
fundc2NP_001005954.1 FUN14 46..134 CDD:282747 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9818
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5306
OMA 1 1.010 - - QHG48305
OrthoDB 1 1.010 - - D1431148at2759
OrthoFinder 1 1.000 - - FOG0002361
OrthoInspector 1 1.000 - - otm26158
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.