DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and Fundc2

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_080402.3 Gene:Fundc2 / 67391 MGIID:1914641 Length:151 Species:Mus musculus


Alignment Length:163 Identity:47/163 - (28%)
Similarity:78/163 - (47%) Gaps:40/163 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNYSEIFKKVFNDIGQRSA-----YS---QMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLE 57
            :|.....::|:|   ||.|.     ||   |::||..:||.||:...|:||.||.||||...||:
Mouse    21 LTKKQPWWRKLF---GQESGPSAEKYSVATQLVIGGVTGWCTGFVFQKVGKLAATAVGGGFFLLQ 82

  Fly    58 IAHQEGLIKINWSKLDKSVDKLADKVEASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKW 122
            :|:..|.||::|.:::|.:.|..::::.    .||.:..||  |.::.:...|.:.:|       
Mouse    83 LANHTGYIKVDWQRVEKDMKKAKEQLKI----RKNKQIPTE--VKSKAEEVVSFVKKN------- 134

  Fly   123 YTKLIGDEEGPKVNDLHIFLASFFGGVALGIAT 155
                            .:....||||..||:|:
Mouse   135 ----------------VLVTGGFFGGFLLGMAS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 36/128 (28%)
Fundc2NP_080402.3 FUN14 49..135 CDD:282747 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10401
eggNOG 1 0.900 - - E1_KOG4099
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5356
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48305
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002361
OrthoInspector 1 1.000 - - otm43782
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3902
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.960

Return to query results.
Submit another query.