DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and LOC365778

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001014273.1 Gene:LOC365778 / 365778 RGDID:1359533 Length:150 Species:Rattus norvegicus


Alignment Length:153 Identity:41/153 - (26%)
Similarity:73/153 - (47%) Gaps:34/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKKVF----NDIGQR-SAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAHQEGLIKI 67
            ::|:|    ...|:: |..:|:|||..:||.||:...|:||.||.||||...||::|:..|.:|:
  Rat    27 WRKLFGHESRSSGEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYVKV 91

  Fly    68 NWSKLDKSVDKLADKVEASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKWYTKLIGDEEG 132
            :|::::|.:.|..:::...         |:.:.......:||.::....|.|             
  Rat    92 DWTRVEKDMKKAKEQLTIR---------KSAQIPTEVKSKAEEVVCFVKKNV------------- 134

  Fly   133 PKVNDLHIFLASFFGGVALGIAT 155
                   :....||||..||:|:
  Rat   135 -------LVTGGFFGGFLLGMAS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 34/128 (27%)
LOC365778NP_001014273.1 FUN14 48..134 CDD:282747 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10389
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5286
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002361
OrthoInspector 1 1.000 - - otm45866
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.