DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and Fundc1

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001020198.1 Gene:Fundc1 / 363442 RGDID:1563372 Length:155 Species:Rattus norvegicus


Alignment Length:164 Identity:41/164 - (25%)
Similarity:77/164 - (46%) Gaps:40/164 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNYS---EIFKKVFND-----IGQRSAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLE 57
            :|.|:   ..:.:||..     :.:.|..:|:::|..:||..|:...|:||.||.||||..:||:
  Rat    23 LTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQ 87

  Fly    58 IAHQEGLIKINWSKLDKSVDKLADKVEASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKW 122
            :|...|.::|:|.:::|.|:|...::       |...:|....::|.::.|...:.:|       
  Rat    88 VASHSGYVQIDWKRVEKDVNKAKRQI-------KKRANKAAPEINNIIEEATDFIKQN------- 138

  Fly   123 YTKLIGDEEGPKVNDLHIFLAS-FFGGVALGIAT 155
                             |.::| |.||..||:|:
  Rat   139 -----------------IVISSGFVGGFLLGLAS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 33/129 (26%)
Fundc1NP_001020198.1 YXXL 18..21
FUN14 54..153 CDD:398543 33/129 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10389
eggNOG 1 0.900 - - E1_KOG4099
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5286
OMA 1 1.010 - - QHG48305
OrthoDB 1 1.010 - - D1431148at2759
OrthoFinder 1 1.000 - - FOG0002361
OrthoInspector 1 1.000 - - otm45866
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - LDO PTHR21346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.