DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and CG12511

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster


Alignment Length:150 Identity:40/150 - (26%)
Similarity:69/150 - (46%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFKKVFNDIGQRSAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAHQEGLIKIN--- 68
            :.|...|.:.|||.|||:.:|.:.|::||:..:|..|..|.|.||:|:.||:|.|.||::::   
  Fly     6 VVKSTMNSLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLK 70

  Fly    69 -WSKLDKSVDKLADKVEASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKWYTKLIGDEEG 132
             :|:|::  |:...::|.   ||.:.:......|....|:|......:|:               
  Fly    71 TFSQLEQ--DQSRGQLEV---REISLEPVNLNRVQELGDKARKACATSGR--------------- 115

  Fly   133 PKVNDLHIFLASFFGGVALG 152
                    ...:|.||..||
  Fly   116 --------LCVAFLGGFLLG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 31/132 (23%)
CG12511NP_608949.2 FUN14 23..119 CDD:282747 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4099
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5376
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - P PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.