DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and SPAC29A4.17c

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_594865.1 Gene:SPAC29A4.17c / 2541621 PomBaseID:SPAC29A4.17c Length:147 Species:Schizosaccharomyces pombe


Alignment Length:58 Identity:22/58 - (37%)
Similarity:32/58 - (55%) Gaps:4/58 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAH--QEGLIKINWSKLDKSV 76
            |.|:.||.|.|...|:...|:|:.  |.|..|.:...||:  .:|||:|||.:|.:.|
pombe    40 YRQIFIGSSLGLAAGFALGKLGRL--FIVACSAVFATIAYINSKGLIRINWPQLQQQV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 20/55 (36%)
SPAC29A4.17cNP_594865.1 FUN14 43..144 CDD:282747 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - LDO PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.