powered by:
Protein Alignment CG5676 and SPAC29A4.17c
DIOPT Version :9
Sequence 1: | NP_609362.1 |
Gene: | CG5676 / 34368 |
FlyBaseID: | FBgn0032200 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594865.1 |
Gene: | SPAC29A4.17c / 2541621 |
PomBaseID: | SPAC29A4.17c |
Length: | 147 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 58 |
Identity: | 22/58 - (37%) |
Similarity: | 32/58 - (55%) |
Gaps: | 4/58 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 YSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAH--QEGLIKINWSKLDKSV 76
|.|:.||.|.|...|:...|:|:. |.|..|.:...||: .:|||:|||.:|.:.|
pombe 40 YRQIFIGSSLGLAAGFALGKLGRL--FIVACSAVFATIAYINSKGLIRINWPQLQQQV 95
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5676 | NP_609362.1 |
FUN14 |
24..153 |
CDD:282747 |
20/55 (36%) |
SPAC29A4.17c | NP_594865.1 |
FUN14 |
43..144 |
CDD:282747 |
20/55 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103323 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR21346 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.