DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5676 and fundc1

DIOPT Version :9

Sequence 1:NP_609362.1 Gene:CG5676 / 34368 FlyBaseID:FBgn0032200 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001120476.1 Gene:fundc1 / 100145592 XenbaseID:XB-GENE-964323 Length:151 Species:Xenopus tropicalis


Alignment Length:137 Identity:38/137 - (27%)
Similarity:66/137 - (48%) Gaps:30/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SAYSQMLIGVSSGWVTGYTTMKIGKFAAFAVGGSIILLEIAHQEGLIKINWSKLDKSVDKLADKV 83
            |..:|:::|..|||..|:...|:||.||.||||..:||:||...|.|:|:|.:::|.|:|...|:
 Frog    45 SVATQIVMGGVSGWCAGFLFQKVGKLAATAVGGGFLLLQIASHGGYIQIDWKRVEKDVNKAKRKI 109

  Fly    84 EASLGREKNWKDKTERYVDNQLDRAESLLTRNGKKVAKWYTKLIGDEEGPKVNDLHIFLASFFGG 148
            :    :|.|   |:...::..::.:...:.:|                       .:....|.||
 Frog   110 K----KEAN---KSVPEINTLIEESTDFIKKN-----------------------IVVSGGFVGG 144

  Fly   149 VALGIAT 155
            ..||:|:
 Frog   145 FLLGLAS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5676NP_609362.1 FUN14 24..153 CDD:282747 34/128 (27%)
fundc1NP_001120476.1 YXXL 14..17
FUN14 50..138 CDD:282747 30/117 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48305
OrthoDB 1 1.010 - - D1431148at2759
OrthoFinder 1 1.000 - - FOG0002361
OrthoInspector 1 1.000 - - otm48956
Panther 1 1.100 - - LDO PTHR21346
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3902
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.