DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and CRK3

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_177210.1 Gene:CRK3 / 843390 AraportID:AT1G70530 Length:646 Species:Arabidopsis thaliana


Alignment Length:491 Identity:114/491 - (23%)
Similarity:195/491 - (39%) Gaps:109/491 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 DGSTYRGVA---NVSASG-KPCLRWSWLMKE-----ISDFPELIGQNYCRNPGSVENSPWCFVDS 296
            :|..|.|..   ||:..| ..|  |..|.:.     :|.....||.......|.| .|..|::..
plant   175 NGGFYAGFVDRHNVTVHGLAQC--WETLNRSGCVECLSKASVRIGSCLVNEEGRV-LSAGCYMRF 236

  Fly   297 SRERII-----ELCDIPKCADKIWIAIVGTTAAIILIFIIIFAIILFKRRTIMHYGMRNIHNINT 356
            |.::..     ...|.....:.:.:.:..|::.:..:.::..|..|.|:|               
plant   237 STQKFYNNSGNSTSDGNGGHNHLGVILAVTSSVVAFVLLVSAAGFLLKKR--------------- 286

  Fly   357 PSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTLLRINHFTLQDVEFLEELGEGAF 421
                   :...|....|......|.|.| ::..:.:.:||.|    ::|:.::     :||:|..
plant   287 -------HAKKQREKKQLGSLFMLANKS-NLCFSYENLERAT----DYFSDKN-----KLGQGGS 334

  Fly   422 GKVYKGQLLQPNKTTITVAIKALKENASVKTQQ---DFKREIELISDLKHQNIVCILGVVLNKEP 483
            |.||||.|....    |||:|.|..|    |:|   .|..|:.|||.:.|:|:|.:||..:....
plant   335 GSVYKGVLTNGK----TVAVKRLFFN----TKQWVDHFFNEVNLISQVDHKNLVKLLGCSITGPE 391

  Fly   484 YCMLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQISEGMQYL---SAHHYVHRDLAARNC 545
            ..:::||:||..||::|......:  .|:..:..:|.|..:|||.||   |....:|||:...|.
plant   392 SLLVYEYIANQSLHDYLFVRKDVQ--PLNWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLSNI 454

  Fly   546 LVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGVVL---- 606
            |:.:....:|:||||:| ::..|...:.:.....:.:|..|.::.||.|.::||:||||::    
plant   455 LLEDDFTPRIADFGLAR-LFPEDKTHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVI 518

  Fly   607 -------------------WEIY-----SYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYS 647
                               |.:|     ...:.|..|    :..|.|.:.:||.....|..|.:.
plant   519 TGKRNNAFVQDAGSILQSVWSLYRTSNVEEAVDPILG----DNFNKIEASRLLQIGLLCVQAAFD 579

  Fly   648 LMIECWHEQSVKRPTFTDISNRLKTWHEGHFKASNP 683
                       :||..:.:...:|...|.|.....|
plant   580 -----------QRPAMSVVVKMMKGSLEIHTPTQPP 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 18/84 (21%)
PTKc_Ror 404..673 CDD:270642 80/302 (26%)
Pkinase_Tyr 410..670 CDD:285015 78/293 (27%)
CRK3NP_177210.1 Stress-antifung 30..127 CDD:396296
Stress-antifung 157..237 CDD:396296 16/64 (25%)
STKc_IRAK 329..593 CDD:270968 78/289 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.