DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and AT5G60270

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_200835.1 Gene:AT5G60270 / 836149 AraportID:AT5G60270 Length:668 Species:Arabidopsis thaliana


Alignment Length:410 Identity:93/410 - (22%)
Similarity:166/410 - (40%) Gaps:92/410 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LIGQNYCRNPGSVENSPWCFVDSSRERIIELCDIPKCADKIWIAIVGTTAAIILIFIIIFAIILF 338
            ::|.::.::..|:.|     :|.|:     |..:|..:.|     ..:|:.::.:.:.:.|.|:.
plant   250 ILGWSFSKSMASLPN-----IDISK-----LPKVPHSSTK-----KKSTSPVLSVLLGLIAFIVL 299

  Fly   339 KRRTIMHYGMRNIHNINTPSADKNI----YGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTL 399
            ....:.:...||:::......:|..    |....|..|                  :|...|:  
plant   300 GILVVAYLYRRNLYSEVREEWEKEYGPIRYSYKSLYKA------------------TKGFNRS-- 344

  Fly   400 LRINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTTI-TVAIKALKENASVKTQQDFKREIELI 463
                          |.||.|.||:||||.|  |....: .||:|.:..:.....:| |..||..:
plant   345 --------------EFLGRGGFGEVYKGTL--PRSRELREVAVKRVSHDGEHGMKQ-FVAEIVSM 392

  Fly   464 SDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQISEGMQ 528
            ..|||:::|.:||....|....::.|||.||.|..:|.::   :..||.....|.|...|:..:.
plant   393 RSLKHRSLVPLLGYCRRKHELLLVSEYMPNGSLDHYLFNH---DRLSLPWWRRLAILRDIASALS 454

  Fly   529 YLSAHH---YVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILY 590
            ||....   .:|||:.|.|.:::.....::.|||:|| :|........:.::..|.:|..|....
plant   455 YLHTEADQVVIHRDIKAANVMLDAEFNGRLGDFGMSR-LYDRGADPSTTAAVGTVGYMAPELTTM 518

  Fly   591 GKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTA---VYSLMIEC 652
            |. :|.:||::|||.|.|: :.|.:|                    .....|.|   :...:.||
plant   519 GA-STGTDVYAFGVFLLEV-TCGRRP--------------------VEPGLPEAKRFLIKWVSEC 561

  Fly   653 WHEQSV---KRPTFTDISNR 669
            |...|:   :.|..|:.|::
plant   562 WKRSSLIDARDPRLTEFSSQ 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 7/37 (19%)
PTKc_Ror 404..673 CDD:270642 74/276 (27%)
Pkinase_Tyr 410..670 CDD:285015 74/270 (27%)
AT5G60270NP_200835.1 Lectin_legB 26..271 CDD:365899 5/30 (17%)
PKc_like 347..613 CDD:389743 73/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.