DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and AT4G28350

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001320081.1 Gene:AT4G28350 / 828950 AraportID:AT4G28350 Length:681 Species:Arabidopsis thaliana


Alignment Length:407 Identity:94/407 - (23%)
Similarity:170/407 - (41%) Gaps:100/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 FPEL---IGQNY---CRNPGSVENSPWCFVDSSRERIIELCDIP-----KCADKIWIAIVGTTAA 324
            |.||   .|:||   ....||..|...... |||:.|..|..||     ...|.:::....:|..
plant   184 FTELKLNSGENYQAWIEFNGSAINVTMARA-SSRKPIRPLISIPLNLTGVLLDDMFVGFTASTGQ 247

  Fly   325 IILIFIIIFAIILFKRRTIMHYGMRN--------IHNINTPSADKNIYGNSQLNNAQDAGRGNLG 381
            ::            :...|:.:...|        :...|.||.  .:.|:|.|.:     :|.:.
plant   248 LV------------QSHRILSWSFSNSNFSIGDALITRNLPSF--KLSGDSVLKS-----KGFIA 293

  Fly   382 NLSDHVALNSKLI-------ERNTLLRINHFTLQDVE----------------------FLEE-- 415
            .:|..|.|...:|       .|....|:.    .|||                      |.:|  
plant   294 GVSSGVVLLVSVIGLLCFYVVRRRRQRLE----GDVEDWETEYWPHRVQYKDVLEATKGFSDENM 354

  Fly   416 LGEGAFGKVYKGQLLQPNKTTITVAIK--ALKENASVKTQQDFKREIELISDLKHQNIVCILGVV 478
            :|.|...|||:| :|:..:    ||:|  .:....||....:|..|:..:..|:|:|||.:.|  
plant   355 IGYGGNSKVYRG-VLEGKE----VAVKRIMMSPRESVGATSEFLAEVSSLGRLRHKNIVGLKG-- 412

  Fly   479 LNK---EPYCMLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQISEGMQYLSAHH-----Y 535
            .:|   |...:::|||.||.:.:.:...:    :.|:..|.:::...::.||.||  |.     .
plant   413 WSKKGGESLILIYEYMENGSVDKRIFDCN----EMLNWEERMRVIRDLASGMLYL--HEGWETKV 471

  Fly   536 VHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLL-PVRWMPSESILYGKFTTESDV 599
            :|||:.:.|.|:::.:..::.||||:: :.::....|.:..:: ...:|..|.:..|:.:.::||
plant   472 LHRDIKSSNVLLDKDMNARVGDFGLAK-LQNTSKEMVSTTHVVGTAGYMAPELVKTGRASAQTDV 535

  Fly   600 WSFGVVLWEIYSYGMQP 616
            :||||.:.|:.. |.:|
plant   536 YSFGVFVLEVVC-GRRP 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 16/51 (31%)
PTKc_Ror 404..673 CDD:270642 61/248 (25%)
Pkinase_Tyr 410..670 CDD:285015 60/242 (25%)
AT4G28350NP_001320081.1 lectin_legume_LecRK_Arcelin_ConA 24..255 CDD:173887 18/83 (22%)
STKc_IRAK 355..621 CDD:270968 56/212 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.