DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and CRK23

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_194062.1 Gene:CRK23 / 828430 AraportID:AT4G23310 Length:830 Species:Arabidopsis thaliana


Alignment Length:361 Identity:97/361 - (26%)
Similarity:175/361 - (48%) Gaps:56/361 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IWIAIVGTTAAIILIFIIIFAIILFKRRTIM-HYGMRNIHNINTPSADKNIYGNSQLNNAQDAGR 377
            |.||:|.:..|::|:|:.:|::...:|:.:: ...:.|:...:|...:........:..|     
plant   432 IIIAVVVSITALLLLFVAVFSVRTKRRKKMIGAIPLLNVKRKDTEVTEPLAENGDSITTA----- 491

  Fly   378 GNLGNLS-DHVALNSKLIERNTLLRINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTTITVAI 441
               |:|. |..|:   :...|..|.||           :||:|.||:||||..    .:.:.||:
plant   492 ---GSLQFDFKAI---VAATNNFLPIN-----------KLGQGGFGEVYKGTF----PSGVQVAV 535

  Fly   442 KALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPT 506
            |.|.: .|.:.:::|:.|:.:::.|:|:|:|.:||..|..|...:::|::.|..|..||...  |
plant   536 KRLSK-TSGQGEREFENEVVVVAKLQHRNLVRLLGYCLEGEEKILVYEFVHNKSLDYFLFDT--T 597

  Fly   507 EGKSLSQLEFLQIALQISEGMQYL---SAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSD 568
            ..:.|......:|...|:.|:.||   |....:||||.|.|.|::..:..|::|||::| |:..|
plant   598 MKRQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMAR-IFGMD 661

  Fly   569 YYRVQSKSLL-PVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSR 632
            .....::.:: ...:|..|..:||:|:.:|||:||||:::||.|       |..|..:.      
plant   662 QTEANTRRVVGTYGYMAPEYAMYGQFSMKSDVYSFGVLVFEIIS-------GMKNSSLY------ 713

  Fly   633 QLLSAPENCPTAVYSLMIECWHEQS---VKRPTFTD 665
            |:..:..|..|..:.|    |...|   :..|:|.|
plant   714 QMDDSVSNLVTYTWRL----WSNGSQLDLVDPSFGD 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 77/269 (29%)
Pkinase_Tyr 410..670 CDD:285015 77/263 (29%)
CRK23NP_194062.1 Stress-antifung 33..129 CDD:279926
Stress-antifung 145..240 CDD:279926
Stress-antifung 258..350 CDD:279926
TyrKc 511..780 CDD:197581 79/271 (29%)
STKc_IRAK 514..781 CDD:270968 77/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.