DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and CRK18

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001320043.1 Gene:CRK18 / 828425 AraportID:AT4G23260 Length:659 Species:Arabidopsis thaliana


Alignment Length:612 Identity:144/612 - (23%)
Similarity:239/612 - (39%) Gaps:187/612 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DVFSTDISSKYPPTRESENLKRICREECELL----ENELCQKEYAIAKRHPVIGMV------GVE 211
            ||.|..|.|      .||:|.:.|.::.:..    |..||...||   ..|..|::      .:.
plant    89 DVCSLCIRS------TSESLLQSCLDQADAFFWSGEETLCLVRYA---NRPFSGLLVMDPLGAIF 144

  Fly   212 DCQKLPQHKDCLSL-----------GITIEVDKTENC---YWEDGSTYRGVANVSA--------S 254
            :..:|..::....:           |||.......|.   |.:|.:......|:||        |
plant   145 NTGELNTNQTVFDIEWNNLTSSMIAGITSSSSGGNNSSKYYSDDIALVPDFKNISALMQCTPDVS 209

  Fly   255 GKPCLRWSWLMKEISDFPELIGQNYCR-NPGSVENSPWCFVDSSRERI------IELCDIPK--- 309
            .:.|.  :.|.:.:.|:     .|.|| :.|.|.:.|.||.   |..:      |:..::||   
plant   210 SEDCN--TCLRQNVVDY-----DNCCRGHQGGVMSRPNCFF---RWEVYPFSGAIDQINLPKSPP 264

  Fly   310 -------------------CADKIWIAIVGTTAAIILIFIIIFAIILFKRRTIMHYGMRNIHNIN 355
                               ...||...:|.|...|||   ::...::..||       :....::
plant   265 PSVTSPSPIANITKNDSRISGGKIAAIVVVTVVTIIL---VVLGFVISNRR-------KQKQEMD 319

  Fly   356 TPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTLLRINHFTLQDVEFLEELGEGA 420
            .|                          ::.|..:.|.||..|    ::|:.::     :||:|.
plant   320 LP--------------------------TESVQFDLKTIESAT----SNFSERN-----KLGKGG 349

  Fly   421 FGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYC 485
            ||:||||.|:  |.|.|  |:|.|.: .|.:.:.:||.|:.:::.|:|.|:|.:||..|..|...
plant   350 FGEVYKGMLM--NGTEI--AVKRLSK-TSGQGEVEFKNEVVVVAKLQHINLVRLLGFSLQGEEKL 409

  Fly   486 MLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQISEGMQYL---SAHHYVHRDLAARNCLV 547
            :::|:::|..|..||.  .||:...|.......|...|:.|:.||   |....:||||.|.|.|:
plant   410 LVYEFVSNKSLDYFLF--DPTKRNQLDWTMRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILL 472

  Fly   548 NEGLVVKISDFGLSRDIYSSDYYRVQSKSLL-PVRWMPSESILYGKFTTESDVWSFGVVLWEIYS 611
            :..:..||:|||::| |:..|.....:..:: ...:|..|.:.:|:|:.:|||:||||::.||.|
plant   473 DADMNPKIADFGMAR-IFGVDQTVANTGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIIS 536

  Fly   612 -------YGM------------------------QPYYG--FSNQEVINLIRSRQLLSAPENCPT 643
                   |.|                        .|:..  |:::|||..|.             
plant   537 GKKNSSFYQMDGLVNNLVTYVWKLWENKSLHELLDPFINQDFTSEEVIRYIH------------- 588

  Fly   644 AVYSLMIECWHEQSVKRPTFTDISNRL 670
                :.:.|..|....|||.:.|...|
plant   589 ----IGLLCVQENPADRPTMSTIHQML 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 18/91 (20%)
KR 235..312 CDD:214527 22/116 (19%)
PTKc_Ror 404..673 CDD:270642 87/304 (29%)
Pkinase_Tyr 410..670 CDD:285015 85/296 (29%)
CRK18NP_001320043.1 Stress-antifung 29..126 CDD:279926 12/42 (29%)
Stress-antifung 150..246 CDD:279926 22/105 (21%)
TyrKc 344..611 CDD:197581 85/291 (29%)
STKc_IRAK 345..613 CDD:270968 86/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.