DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and CRK34

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001319904.1 Gene:CRK34 / 826757 AraportID:AT4G11530 Length:676 Species:Arabidopsis thaliana


Alignment Length:655 Identity:147/655 - (22%)
Similarity:247/655 - (37%) Gaps:180/655 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLLFTKKDVGSHNVDSRIYGFQQS-----------SGICHIYNGT---ICRDVLSNAHVFVS--- 61
            :|.....:|.|||      ||..|           :|:|  ..||   .|.|.:..|...:|   
plant    45 ILSTLSSNVTSHN------GFFNSKFGQAPNRVFINGMC--IPGTKPETCSDCIKGASDKISESC 101

  Fly    62 PNLTMNDLEERLKAAYGVIKESKDMNANCRMYALPSLCFSSMPICRTPERTNLLYFANVATNAKQ 126
            ||.|                         ..|..|..|              ::.::||:.:...
plant   102 PNKT-------------------------DAYTWPDCC--------------MVRYSNVSFSGSL 127

  Fly   127 LKNVSIRRKRTKSKDIK----NISIFKKKSTIYEDVFSTDISSKYPPTRESENLKRICREECELL 187
            :...|.....|  .||:    |:::|.:   |:|::....|::   .:..|.|            
plant   128 VMEPSETLYHT--GDIEDTGTNLTVFDR---IWEELMLRTITA---ASLSSSN------------ 172

  Fly   188 ENELCQKEYA--IAKRHPVIGMVGVEDCQKLPQHKDCLSLGITIEVDKTENCYWEDGSTYRGVAN 250
            .:...||.:|  :|.......|..:..|......||| ...:...|...|:|       .||...
plant   173 GSSFGQKYFAAEVASLTTFQTMYAMMQCTPDVSSKDC-EFCLKTSVGDYESC-------CRGKQG 229

  Fly   251 VSASGKPC-LRW-----SWLMKEISDFPELIGQNYCRNPGSVENSPWCFVDSSRERIIELCDIPK 309
            .:.....| :||     :...:.:: ||....|:..:.|.|:...|   |.......|:  |...
plant   230 GAVIRPSCFVRWDLYPYAGAFENVT-FPPPPPQSLPQPPVSLIPPP---VSDRANTTIK--DGKS 288

  Fly   310 CADKIWIAIVGTTAAIILIFIIIFAIILFKRRTIMHYGMRNIHNINTPSADKNIYGNSQLNNAQD 374
            .:..|.:|||   ..||:|.:.:..:::..||                   |..|..:::     
plant   289 FSTGIIVAIV---VPIIVILVSLVVLLVVCRR-------------------KKSYKTTEV----- 326

  Fly   375 AGRGNLGNLSDHVALNSKLIERNTLLRINHFTLQDVEFLEE-------LGEGAFGKVYKGQLLQP 432
                   ..:|.:.....|          .|:.:.:|...:       :|.|.||:||:|:|   
plant   327 -------QATDEITTTHSL----------QFSFKTIEAATDKFSDSNMIGRGGFGEVYRGKL--- 371

  Fly   433 NKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLH 497
             .:...||:|.|.: .|.:..::||.|..|:|.|:|:|:|.:||..|..|...:::|::.|..|.
plant   372 -SSGPEVAVKRLSK-TSGQGAEEFKNEAVLVSKLQHKNLVRLLGFCLEGEEKILVYEFVPNKSLD 434

  Fly   498 EFLISNSPTEGKSLSQLEFLQIALQISEGMQYL---SAHHYVHRDLAARNCLVNEGLVVKISDFG 559
            .||.  .|.:...|.......|...|:.|:.||   |....:||||.|.|.|::..:..||:|||
plant   435 YFLF--DPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFG 497

  Fly   560 LSRDIYSSDYYRVQSKSLL-PVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQ 623
            ::| |:..|..:..::.:. ...:|..|..:.|.|:.:|||:||||::.||.|       |..|.
plant   498 MAR-IFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIIS-------GKKNS 554

  Fly   624 EVINL 628
            ...|:
plant   555 SFYNI 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 36/200 (18%)
KR 235..312 CDD:214527 16/82 (20%)
PTKc_Ror 404..673 CDD:270642 73/236 (31%)
Pkinase_Tyr 410..670 CDD:285015 72/230 (31%)
CRK34NP_001319904.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.