DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and AT3G53380

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_190906.1 Gene:AT3G53380 / 824506 AraportID:AT3G53380 Length:715 Species:Arabidopsis thaliana


Alignment Length:290 Identity:70/290 - (24%)
Similarity:127/290 - (43%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 LGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLN 480
            :|.||||.||:|.|   .:|...||:|....::..| :.:|..|:.:|..|:|:|:|.:.|....
plant   382 IGHGAFGVVYRGIL---PETGDIVAVKRCSHSSQDK-KNEFLSELSIIGSLRHRNLVRLQGWCHE 442

  Fly   481 KEPYCMLFEYMANGDLHEFLISNS---PTEGKSLSQLEFLQIALQISEGMQYL---SAHHYVHRD 539
            |....::::.|.||.|.:.|..:.   |.:.:.       :|.|.::..:.||   ..:..:|||
plant   443 KGEILLVYDLMPNGSLDKALFESRFTLPWDHRK-------KILLGVASALAYLHRECENQVIHRD 500

  Fly   540 LAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGV 604
            :.:.|.:::|....|:.||||:|.| ..|.....:.:...:.::..|.:|.|:.:.::||:|:|.
plant   501 VKSSNIMLDESFNAKLGDFGLARQI-EHDKSPEATVAAGTMGYLAPEYLLTGRASEKTDVFSYGA 564

  Fly   605 VLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIE------------------ 651
            |:.|:.| |.:|.     ::.:|:  .|..:....|....|:.|..|                  
plant   565 VVLEVVS-GRRPI-----EKDLNV--QRHNVGVNPNLVEWVWGLYKEGKVSAAADSRLEGKFDEG 621

  Fly   652 -----------CWHEQSVKRPTFTDISNRL 670
                       |.|.....|||...:...|
plant   622 EMWRVLVVGLACSHPDPAFRPTMRSVVQML 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 70/290 (24%)
Pkinase_Tyr 410..670 CDD:285015 69/288 (24%)
AT3G53380NP_190906.1 lectin_legume_LecRK_Arcelin_ConA 22..244 CDD:173887
Pkinase 376..650 CDD:278497 69/287 (24%)
STKc_IRAK 382..651 CDD:270968 69/288 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.