DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and AT3G45440

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001327867.1 Gene:AT3G45440 / 823682 AraportID:AT3G45440 Length:722 Species:Arabidopsis thaliana


Alignment Length:488 Identity:114/488 - (23%)
Similarity:190/488 - (38%) Gaps:135/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 WEDGSTYRG-VANVSAS-------GKPCLRWSWLMKEISDFPE-------------------LIG 276
            |.|   |.| |.||:.:       .:|.|..|..:.|  .||:                   ::|
plant   247 WVD---YGGNVLNVTLAPLKIQKPSRPLLSRSINLSE--TFPDRKFFLGFSGATGTLISYQYILG 306

  Fly   277 QNYCRNPGSVENSPWCFVDSSRERIIELCDIPKCADKIWIAIVGTTAAIILIFIIIF----AIIL 337
            .:..||..|::.     :|     :.:|..:|:...|.....|.....:||:.||:|    |..:
plant   307 WSLSRNKVSLQT-----LD-----VTKLPRVPRHRAKNKGPSVVLIVLLILLAIIVFLALGAAYV 361

  Fly   338 FKRRTI--------MHYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLI 394
            ::||..        ..||....       :.|::|                              
plant   362 YRRRKYAEIREEWEKEYGPHRF-------SYKDLY------------------------------ 389

  Fly   395 ERNTLLRINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKRE 459
                 :..|.|....:     ||:|.|||||||.|  |:|..|  |:|.:..:|....:| |..|
plant   390 -----IATNGFNKDGL-----LGKGGFGKVYKGTL--PSKGQI--AVKRVSHDAEEGMKQ-FVAE 439

  Fly   460 IELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQIS 524
            |..:.:|||:|:|.:||....|....::.|||.||.|.::|.::   |....|....|.|...|:
plant   440 IVSMGNLKHKNMVPLLGYCRRKGELLLVSEYMPNGSLDQYLFND---EKPPFSWRRRLLIIKDIA 501

  Fly   525 EGMQYL---SAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSE 586
            ..:.|:   :....:|||:.|.|.:::.....::.|||::| .:........:.::..:.:|..|
plant   502 TALNYMHTGAPQVVLHRDIKASNVMLDTEFNGRLGDFGMAR-FHDHGKDPATTAAVGTIGYMAPE 565

  Fly   587 SILYGKFTTESDVWSFGVVLWEIYSYGMQPYY-GFSNQ------------EVINLI-----RSRQ 633
            ....|. .|.:||:.||..|.|: :.|.:|.. |.|.:            ::.:|:     |.|.
plant   566 LATVGA-CTATDVYGFGAFLLEV-TCGRRPVEPGLSAERWYIVKWVCECWKMASLLGARDPRMRG 628

  Fly   634 LLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666
            .:||.|  ...|..|.:.|.:.....||:..||
plant   629 EISAEE--VEMVLKLGLLCTNGVPDLRPSMEDI 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 20/99 (20%)
PTKc_Ror 404..673 CDD:270642 79/284 (28%)
Pkinase_Tyr 410..670 CDD:285015 78/278 (28%)
AT3G45440NP_001327867.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.