DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and Musk

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_112323.2 Gene:Musk / 81725 RGDID:3211 Length:868 Species:Rattus norvegicus


Alignment Length:684 Identity:205/684 - (29%)
Similarity:306/684 - (44%) Gaps:185/684 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QQSSGICHIYNGTICRDVL-SNAHVFVSPNLTMNDLEER----LKAAYGVIKESKDMNANCRMYA 94
            ::|.|.|..|.|.:|..|| .::.||.  |.:..|.||.    :..|:   .|.|.::..||..|
  Rat   311 KESKGYCAQYRGEVCDAVLVKDSLVFF--NTSYPDPEEAQELLIHTAW---NELKAVSPLCRPAA 370

  Fly    95 LPSLCFSSMPICRTPERTNLLYFANVATNAKQLKNVSIRRKRTKSKDIKNISIFKKKSTIYEDVF 159
            ...||                                                    :.::::..
  Rat   371 EALLC----------------------------------------------------NHLFQECS 383

  Fly   160 STDISSKYPPTRESENLKRICREECELLENELCQKEYAI--AKRHPVI---GM--VGVEDCQKLP 217
            |..:.:..|          ||||.|..::...|.||:..  .|.|..:   ||  :.|.:|.|||
  Rat   384 SGVLPTPMP----------ICREYCLAVKELFCAKEWLAMEGKTHRGLYRSGMHFLPVPECSKLP 438

  Fly   218 -QHKDCLSLGITIEVDKTENCYWEDGSTYRGVANVSASGKPCLRWSWL---MKEISDFPELIGQN 278
             .|:|..:                                 |.|..:|   .:.|:.||.:    
  Rat   439 SMHQDPTA---------------------------------CTRLPYLDYKKENITTFPSI---- 466

  Fly   279 YCRNPGSVENSPWCFVDSSRERIIELCDIPKCADKIWIAIVGTTAAIILIFIIIFAIILFKRRTI 343
                             :|.:..:::.::|.......::...:...||.| :..||:......|.
  Rat   467 -----------------TSSKPSVDIPNLPASTSSFAVSPAYSMTVIISI-MSCFAVFALLTITT 513

  Fly   344 MHYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALN----SKLIERNTLLRIN- 403
            ::...|.               ....|..:::....|..|...:.|:    :.:.:|..|| :| 
  Rat   514 LYCCRRR---------------REWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLL-LNP 562

  Fly   404 -----HFTLQDVEFLEELGEGAFGKVYKGQL--LQPNKTTITVAIKALKENASVKTQQDFKREIE 461
                 .:...::|::.::||||||:|::.:.  |.|.:....||:|.|||.||...|.||:||..
  Rat   563 KLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAA 627

  Fly   462 LISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQ------------- 513
            |:::..:.|||.:|||....:|.|:||||||.|||:|||.|.||....|||.             
  Rat   628 LMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPG 692

  Fly   514 ------LEFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRV 572
                  .|.|.||.|::.||.|||...:||||||.|||||.|.:||||:||||||:|||:|||:.
  Rat   693 PPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKA 757

  Fly   573 QSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSA 637
            .....:|:||||.|||.|.::|||||||::|||||||:|||:|||||.:::|||..:|...:|:.
  Rat   758 DGNDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILAC 822

  Fly   638 PENCPTAVYSLMIECWHEQSVKRPTFTDISNRLK 671
            |||||..:|:||..||.:....||:|..|...|:
  Rat   823 PENCPLELYNLMRLCWSKLPADRPSFCSIHRILQ 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 42/201 (21%)
KR 235..312 CDD:214527 8/79 (10%)
PTKc_Ror 404..673 CDD:270642 139/289 (48%)
Pkinase_Tyr 410..670 CDD:285015 138/280 (49%)
MuskNP_112323.2 IgI_1_MuSK 28..117 CDD:409562
Ig strand B 45..49 CDD:409562
Ig strand C 58..62 CDD:409562
Ig strand E 82..86 CDD:409562
Ig strand F 96..101 CDD:409562
Ig strand G 110..113 CDD:409562
IgI_2_MuSK 122..209 CDD:409560
Ig strand B 138..142 CDD:409560
Ig strand C 151..155 CDD:409560
Ig strand E 173..177 CDD:409560
Ig strand F 187..192 CDD:409560
Ig strand G 201..204 CDD:409560
Ig_3 218..286 CDD:404760
Ig strand A' 222..225 CDD:409353
Ig strand B 229..236 CDD:409353
Ig strand C 242..247 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 258..262 CDD:409353
Ig strand E 268..272 CDD:409353
Ig strand F 278..286 CDD:409353
CRD_TK_ROR_related 313..457 CDD:143578 46/243 (19%)
PTKc_Musk 568..857 CDD:133181 139/289 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222671at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.