DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and smal

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:54/140 - (38%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 ELIGQN-YCRNPGSVENSPWCFVDSSRERIIELCDIPKCADKIWIAIVG-TTAAIILIFIIIFAI 335
            :::|.| |...|..:...|   :|..          |..|:.|.:.||. ||..|:|:.||:|.:
  Fly   473 DIVGNNKYNNGPQLIAPRP---IDQE----------PNDANFIGVVIVVLTTIIILLVAIILFIV 524

  Fly   336 ILFKRRTIMHYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTL- 399
            ...||          ....|...|.:..:..:.|....|..|.|..::..:|..|.. |.:|:| 
  Fly   525 SRTKR----------ARGSNVLDAFQYSFNPNTLGGNVDKHRPNGNSIKANVDDNDS-IGKNSLY 578

  Fly   400 ---LRINHFT 406
               ..:|.:|
  Fly   579 HEPFNVNMYT 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 7/39 (18%)
PTKc_Ror 404..673 CDD:270642 1/3 (33%)
Pkinase_Tyr 410..670 CDD:285015
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.