DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and MUSK

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:XP_005252051.1 Gene:MUSK / 4593 HGNCID:7525 Length:879 Species:Homo sapiens


Alignment Length:677 Identity:200/677 - (29%)
Similarity:307/677 - (45%) Gaps:170/677 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QQSSGICHIYNGTICRDVLS-NAHVFVSPNLTMNDLEERLK-AAYGVIKESKDMNANCRMYALPS 97
            :.:.|.|..|.|.:|..||: :|.||:  |.:..|.||..: ..:....|.|.::..||..|...
Human   321 KDNKGYCAQYRGEVCNAVLAKDALVFL--NTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEAL 383

  Fly    98 LCFSSMPICRTPERTNLLYFANVATNAKQLKNVSIRRKRTKSKDIKNISIFKKKSTIYEDVFSTD 162
            ||                                                    :.|:::.....
Human   384 LC----------------------------------------------------NHIFQECSPGV 396

  Fly   163 ISSKYPPTRESENLKRICREECELLENELCQKEYAIAKRHPVIG-------MVGVEDCQKLPQHK 220
            :.:..|          ||||.|..::...|.||:.:.:.....|       ::.|.:|.|||   
Human   397 VPTPIP----------ICREYCLAVKELFCAKEWLVMEEKTHRGLYRSEMHLLSVPECSKLP--- 448

  Fly   221 DCLSLGITIEVDKTENCYWEDGSTYRGVANVSASGKPCLRWSWLMKEISDFPELIGQNYCRNPGS 285
                           :.:|:..:..|         .|.|.::  .:.:..||.:           
Human   449 ---------------SMHWDPTACAR---------LPHLDYN--KENLKTFPPM----------- 476

  Fly   286 VENSPWCFVDSSRERIIELCDIPKCADKIWIAIVGTTAAIILIFIIIFAIILFKRRTIMHYGMRN 350
                      :|.:..:::.::|..:...:......:..:|:..:..|||.:....|.::...|.
Human   477 ----------TSSKPSVDIPNLPSSSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRR 531

  Fly   351 IHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALN----SKLIERNTLLRIN------HF 405
                           ....|..:::....|..|...:.|:    :.:.:|..|| :|      .:
Human   532 ---------------KQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLL-LNPKLLSLEY 580

  Fly   406 TLQDVEFLEELGEGAFGKVYKGQL--LQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKH 468
            ...::|::.::||||||:|::.:.  |.|.:....||:|.|||.||...|.||:||..|:::..:
Human   581 PRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDN 645

  Fly   469 QNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQ-------------------L 514
            .|||.:|||....:|.|:||||||.|||:|||.|.||....|||.                   .
Human   646 PNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCA 710

  Fly   515 EFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLP 579
            |.|.||.|::.||.|||...:||||||.|||||.|.:||||:||||||:|||:|||:......:|
Human   711 EQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIP 775

  Fly   580 VRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTA 644
            :||||.|||.|.::|||||||::|||||||:|||:|||||.:::|||..:|...:||.|||||..
Human   776 IRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVE 840

  Fly   645 VYSLMIECWHEQSVKRPTFTDISNRLK 671
            :|:||..||.:....||:||.|...|:
Human   841 LYNLMRLCWSKLPADRPSFTSIHRILE 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 37/197 (19%)
KR 235..312 CDD:214527 8/76 (11%)
PTKc_Ror 404..673 CDD:270642 141/289 (49%)
Pkinase_Tyr 410..670 CDD:285015 140/280 (50%)
MUSKXP_005252051.1 I-set 28..117 CDD:254352
Ig 36..117 CDD:299845
I-set 121..203 CDD:254352
Ig 135..201 CDD:299845
I-set 223..306 CDD:254352
Ig 239..306 CDD:143165
CRD_FZ 325..467 CDD:295308 41/234 (18%)
PTKc_Musk 579..868 CDD:133181 141/289 (49%)
Pkinase_Tyr 585..866 CDD:285015 140/280 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222671at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.