DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and Cad96Ca

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:272 Identity:100/272 - (36%)
Similarity:162/272 - (59%) Gaps:11/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 VEFLEELGEGAFGKVYKGQL--LQPNKTTITVAIKALKENASVKTQQDFKREIELISDLK-HQNI 471
            ::|...|||||||:|::.:.  :..|:...|||:|.|||:|:...::|...|:|::..|: |.|:
  Fly   470 LKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINV 534

  Fly   472 VCILGVVLNKEPYCMLFEYMANGDLHEFLISN------SPTEGKS--LSQLEFLQIALQISEGMQ 528
            |.:||...:|:|..::.||:..|.|..:|.|:      ..|.|||  |:..:......|:::||.
  Fly   535 VHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCDLTSFMYQVAKGMD 599

  Fly   529 YLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKF 593
            ||::...:||||||||.|:.:....|::|||.:||:.:|..|..:|:..||:|||.:||:....|
  Fly   600 YLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMATESLYDNIF 664

  Fly   594 TTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQSV 658
            :.:||:||||:::|||.:.|..||.|.|..:|:..:|....|..||:|...:|::|..||.....
  Fly   665 SVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQ 729

  Fly   659 KRPTFTDISNRL 670
            :||.|.:|...|
  Fly   730 ERPLFAEIIQML 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 100/272 (37%)
Pkinase_Tyr 410..670 CDD:285015 99/270 (37%)
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 99/270 (37%)
PTKc 474..742 CDD:270623 99/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455358
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.