DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and btl

DIOPT Version :9

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:408 Identity:128/408 - (31%)
Similarity:201/408 - (49%) Gaps:76/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 VGTTAA---IILIFIIIFAIILF-----KRRTIMHYGMRNIHN------INTPSADKNIYGNSQL 369
            :|.|.|   |:.:|::..|.|.|     :|..::...:..:|.      |..|..::        
  Fly   601 LGFTLAAITIVALFLLGSAFITFMLRRLRREKLLKLRIETVHQWTKKVIIYRPGGEE-------- 657

  Fly   370 NNAQDAGRG-NLGNLSDHVALNSKLIERNTLLRIN-------------HFTL--------QDVEF 412
                  |.| :.|:|...|....|  :|.|:....             .|.|        |.:..
  Fly   658 ------GSGCSSGDLQMPVIRIEK--QRTTVSTTGTGGTDPAQGFNEYEFPLDSNWEIPRQQLSL 714

  Fly   413 LEELGEGAFGKVY----KGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDL-KHQNIV 472
            ...|||||||:|.    :|....|......||:|.:||..:........||:|::..: ||.||:
  Fly   715 GSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINII 779

  Fly   473 CILGVVLNKEPYCMLFEYMANGDLHEFLISNSP--------TEG----------KSLSQLEFLQI 519
            .:||......|..::.||..:|:|.:||..|.|        ::|          :.|.:.|..:.
  Fly   780 NLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKF 844

  Fly   520 ALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMP 584
            |.||:.||:||::...:||||||||.||::|.|:||:||||:|||..::|||..:...||::||.
  Fly   845 AFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMA 909

  Fly   585 SESILYGKFTTESDVWSFGVVLWEIYSYGMQPY-YGFSNQEVINLIRSRQLLSAPENCPTAVYSL 648
            .||:...|:.::|||||:||:||||.:||.||| :..|.:|:.:.:.:.|.:..|..|...:|.:
  Fly   910 PESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVV 974

  Fly   649 MIECWHEQSVKRPTFTDI 666
            |.:|||.:|..||||.::
  Fly   975 MRQCWHFESCARPTFAEL 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 108/295 (37%)
Pkinase_Tyr 410..670 CDD:285015 105/281 (37%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 107/293 (37%)
TyrKc 712..996 CDD:197581 105/281 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455246
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.