DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ror and Tie

DIOPT Version :10

Sequence 1:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:162 Identity:30/162 - (18%)
Similarity:58/162 - (35%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KELYGYQHNMGLLLMENK----ELVSKHEQLNQAFQEAQEILKREQSSHLYALTTVE-------- 159
            |:..|:.....:|:.:..    |:.:..|||...::.:...|..:..:|....|.::        
  Fly    68 KQCEGFTFRKSILIGKTDLGPLEVRATMEQLADNYKGSSYNLITKNCNHFCDETCIKLTGNPIPS 132

  Fly   160 --QREENLRKALGLEKQCVQELEKAL-------------REIQEENSKIRLSSEAKLVEANALVA 209
              .|...:.|..|....||  |...:             :..:.||.|.:|:|.:....:.....
  Fly   133 WVNRLARIGKFSGFMCNCV--LPATINATRFGNNRVNQDKSCEAENEKKKLTSVSSRERSTIATP 195

  Fly   210 SVNGRSSDVENKIYSAESKLAEATRKSSELKL 241
            |.:..|..|:.:..|.:.: ..|.:.||.|.|
  Fly   196 SSSSSSPSVQVRGRSRKRR-PRALQPSSPLTL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 25/147 (17%)
KR 235..312 CDD:214527 4/7 (57%)
PTKc_Ror 404..673 CDD:270642
TieNP_523928.1 TyrKc 854..1183 CDD:197581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.